PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn280391
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 223aa    MW: 23524 Da    PI: 7.4339
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn280391genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.53e-382381361
      zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                 ++l+cprC+stntkfCyynny+lsqPr+fCk+CrryWt+GG+lrnvPvGgg+r+++++
  Achn280391 23 PEQLPCPRCESTNTKFCYYNNYNLSQPRHFCKSCRRYWTRGGTLRNVPVGGGTRNKNTN 81
                6789**************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-242179IPR003851Zinc finger, Dof-type
PfamPF027012.5E-322579IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9662680IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102864IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MPPETSDRRP VRMQHGGAHP PEPEQLPCPR CESTNTKFCY YNNYNLSQPR HFCKSCRRYW  60
TRGGTLRNVP VGGGTRNKNT NKRSRTAAAT SSSSSSSLPE REPANPITVL PGIKTHNNTA  120
PLYADVDLNE NVPEADSYAS FLNPHGGGLF PLGGFGFGFG VGTGIWHMED VSGGNGGGGG  180
GVSGAEPGCN AWQVGSGESE LADVDCFGWP DLAISTPGKG LK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572515e-47DQ857251.1 Glycine max Dof2 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002284108.15e-63PREDICTED: dof zinc finger protein DOF3.4
TrEMBLF6H1E95e-63F6H1E9_VITVI; Putative uncharacterized protein
STRINGVIT_18s0001g11310.t012e-62(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45322241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.11e-33DOF zinc finger protein 1